PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011071865.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 331aa    MW: 36358.3 Da    PI: 6.9434
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011071865.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.24.9e-4058118262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     +e++lkcprCdst+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+s
  XP_011071865.1  58 HEQSLKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVS 118
                     57899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2852112IPR003851Zinc finger, Dof-type
PfamPF027011.9E-3360116IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.18962116IPR003851Zinc finger, Dof-type
PROSITE patternPS01361064100IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGITSLQVCM DSSDWLQQGT ISEEGTGMDS SPITTPSGDD SILACSRPLI ERRLRPPHEQ  60
SLKCPRCDST HTKFCYYNNY SLSQPRYFCK TCRRYWTKGG TLRNIPVGGG CRKNKKVSSS  120
KKPSSSSSSD HQIHQNHSSS SSSSPLILNQ SPMLPYNNIP SSSDHLQLGN YPDHHHHQLQ  180
FSSSLGLLAP NPTPIDFMME NKYDDAFMGN GGIMPGQSFA ADFHGICSPF GFSSLDHGIN  240
SAAAGSSVLE SCQRLMLPYD ENHGHHLDHQ NHHEIHDVKP NAKILSLEWH DQQQACNPDA  300
GKDTFGYNFG GLGSWTGLMN GYGSSATNPL V
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3763885e-51AK376388.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3122H18.
GenBankAM0843605e-51AM084360.1 Hordeum vulgare subsp. vulgare dof12 gene for dof zinc finger protein 12, exons 1-2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071865.10.0PREDICTED: dof zinc finger protein DOF5.6 isoform X1
SwissprotQ9FM032e-60DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLA0A061FUJ41e-106A0A061FUJ4_THECC; F-box family protein isoform 2 (Fragment)
TrEMBLA0A061FV521e-105A0A061FV52_THECC; Dof-type zinc finger DNA-binding family protein isoform 1
STRINGPOPTR_0015s08810.11e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48952240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.13e-47Dof family protein